Precision Immunotherapy for NSCLC: Multi-epitope Peptide Vaccine Targeting VEGF-A, TGF-β and MAGE-A3 Increases Antitumor Key Cytokine Balance
Archives of Advances in Biosciences,
Vol. 16 No. 1 (2025),
2 March 2025
,
Page 1-21
https://doi.org/10.22037/aab.v16i1.50519
Abstract
Introduction: Lung cancer remains the leading cause of cancer-related mortality worldwide, underscoring the urgent need for advancements in treatment options. Although, current standard interventions, including surgery, radiotherapy and chemotherapy are widely employed, a significant number of patients experience relapses, highlighting the critical demand for innovative therapeutic strategies. This study was conducted to develop and evaluate a novel multi-epitope peptide vaccine designed from VEGF-A, TGF-β and MAGE-A3 markers, with the aim of enhancing therapeutic efficacy. Lung cancer remains the leading cause of cancer-related mortality worldwide, underscoring the pressing need for more effective therapeutic interventions. Although current standard treatments—including surgery, radiotherapy, and chemotherapy—are widely utilized, a substantial proportion of patients experience disease recurrence, highlighting the necessity for innovative therapeutic strategies. In this study, we developed and evaluated a novel multi-epitope peptide vaccine constructed from VEGF-A, TGF-β, and MAGE-A3 markers, with the objective of enhancing therapeutic efficacy.
Materials and Methods: Optimal epitopes from VEGF-A, TGF-β, and MAGE-A3 were systematically identified and selected, and subsequently conjugated using a KKK linker to form the final multi-epitope vaccine construct. Two groups of BALB/c mice were immunized with the peptide at concentrations of 10 mg/mL and 100 mg/mL, following an immunization protocol that included three weekly administrations. In the fourth week, spleen tissue was collected from the mice to assess the expression levels of IFN-γ, IL-4, IL-6, TNF-α, and IL-10 cytokine genes, thereby enabling a comprehensive evaluation of the immunogenic and functional efficacy of the peptide vaccine.
Results: Bioinformatics evaluations have revealed a promising multi-epitope peptide vaccine,SVRGKGKGQKRKRKKSKKKHHMVKISGGPHISYPPKKKRLESQQTNRRKKRALD.
This peptide notably enhances the expression of key cytokine genes, including TNF-α, IL-6, IFN-γ, IL-4 and IL-10 among the group that received the vaccine at a dose of 10. Even more pronounced levels of gene expression were observed at the higher dose of 100.
Conclusion: This multi-epitope peptide demonstrates considerable potential to elicit a robust immune response and effectively target cancer cells. We strongly recommend conducting further supplementary tests to evaluate its efficacy and possible side effects.
- Multi epitope Peptide Vaccine
- NSCLC
- Cytokine genes
- Immunotherapy
How to Cite
References
[1] Herbst RS, Morgensztern D, Boshoff C. The biology and management of non-small cell lung cancer. Nature. 2018;553(7689):446-54. [DOI: 10.1038/nature25183] [PMID]
[2] Hu W, Wu H, Li A, Zheng X, Zhang W, Tian Q, et al. Pseudogene CSPG4P12 affects the biological behavior of non-small cell lung cancer by Bcl-2/Bax mitochondrial apoptosis pathway. Exp Ther Med. 2022;24(6):734. [DOI: 10.3892/etm.2022.11670] [PMID]
[3] Gridelli C, Rossi A, Carbone DP, Guarize J, Karachaliou N, Mok T, et al. Non-small-cell lung cancer. Nat Rev Dis Primers. 2015;1:15009. [DOI: 10.1038/nrdp.2015.9] [PMID]
[4] Chen DS, Mellman I. Elements of cancer immunity and the cancer-immune set point. Nature. 2017;541(7637):321-30. [DOI: 10.1038/nature21349] [PMID]
[5] Wang XE, Wang YH, Zhou Q, Peng M, Zhang J, Chen M, et al. Immunomodulatory effect of lentinan on aberrant T subsets and cytokines profile in non-small cell lung cancer patients. Pathol Oncol Res. 2020;26(1):499-505. [DOI: 10.1007/s12253-018-0545-y] [PMID]
[6] Balkwill F. Tumour necrosis factor and cancer. Nat Rev Cancer. 2009;9(5):361-71. [DOI: 10.1038/nrc2628] [PMID]
[7] Benoot T, Piccioni E, De Ridder K, Goyvaerts C. TNFalpha and immune checkpoint inhibition: friend or foe for lung cancer? Int J Mol Sci. 2021;22(16):8691. [DOI: 10.3390/ijms22168691] [PMID]
[8] Ke W, Zhang L, Dai Y. The role of IL-6 in immunotherapy of non-small cell lung cancer (NSCLC) with immune-related adverse events (irAEs). Thorac Cancer. 2020;11(4):835-9. [DOI: 10.1111/1759-7714.13341] [PMID]
[9] Guo Y, Xu F, Lu T, Duan Z, Zhang Z. Interleukin-6 signaling pathway in targeted therapy for cancer. Cancer Treat Rev. 2012;38(7):904-10. [DOI: 10.1016/j.ctrv.2012.04.007] [PMID]
[10] Fu C, Jiang L, Hao S, Liu Z, Ding S, Zhang W, et al. Activation of the IL-4/STAT6 signaling pathway promotes lung cancer progression by increasing M2 myeloid cells. Front Immunol. 2019;10:2638. [DOI: 10.3389/fimmu.2019.02638] [PMID]
[11] Safi S, Yamauchi Y, Hoffmann H, Weichert W, Jost PJ, Winter H, et al. Circulating interleukin-4 is associated with a systemic T cell response against tumor-associated antigens in treatment-naive patients with resectable non-small-cell lung cancer. Cancers (Basel). 2020;12(12):3496. [DOI: 10.3390/cancers12123496] [PMID]
[12] Ouyang W, Lohning M, Gao Z, Assenmacher M, Ranganath S, Radbruch A, et al. Stat6-independent GATA-3 autoactivation directs IL-4-independent Th2 development and commitment. Immunity. 2000;12(1):27-37. [DOI: 10.1016/S1074-7613(00)80156-9] [PMID]
[13] Saraiva M, O'Garra A. The regulation of IL-10 production by immune cells. Nat Rev Immunol. 2010;10(3):170-81. [DOI: 10.1038/nri2711] [PMID]
[14] Couper KN, Blount DG, Riley EM. IL-10: the master regulator of immunity to infection. J Immunol. 2008;180(9):5771-7. [DOI: 10.4049/jimmunol.180.9.5771] [PMID]
[15] Ouyang W, Rutz S, Crellin NK, Valdez PA, Hymowitz SG. Regulation and functions of the IL-10 family of cytokines in inflammation and disease. Annu Rev Immunol. 2011;29:71-109. [DOI: 10.1146/annurev-immunol-031210-101312] [PMID]
[16] Yu H, Pardoll D, Jove R. STATs in cancer inflammation and immunity: a leading role for STAT3. Nat Rev Cancer. 2009;9(11):798-809. [DOI: 10.1038/nrc2734] [PMID]
[17] Hodge G, Barnawi J, Jurisevic C, Moffat D, Holmes M, Reynolds PN, et al. Lung cancer is associated with decreased expression of perforin, granzyme B and interferon (IFN)-gamma by infiltrating lung tissue T cells, natural killer (NK) T-like and NK cells. Clin Exp Immunol. 2014;178(1):79-85. [DOI: 10.1111/cei.12392] [PMID]
[18] Jorgovanovic D, Song M, Wang L, Zhang Y. Roles of IFN-gamma in tumor progression and regression: a review. Biomark Res. 2020;8:49. [DOI: 10.1186/s40364-020-00228-x] [PMID]
[19] Wong CW, Huang YY, Hurlstone A. The role of IFN-gamma-signalling in response to immune checkpoint blockade therapy. Essays Biochem. 2023;67(6):991-1002. [DOI: 10.1042/EBC20230001] [PMID]
[20] Abd-Aziz N, Poh CL. Development of peptide-based vaccines for cancer. J Oncol. 2022;2022:9749363. [DOI: 10.1155/2022/9749363] [PMID]
[21] Buonaguro L, Tagliamonte M. Peptide-based vaccine for cancer therapies. Front Immunol. 2023;14:1210044. [DOI: 10.3389/fimmu.2023.1210044] [PMID]
[22] Rahman MM, Masum MHU, Talukder A, Akter R. An in silico reverse vaccinology approach to design a novel multiepitope peptide vaccine for non-small cell lung cancers. Inform Med Unlocked. 2023;37:101169. [DOI: 10.1016/j.imu.2023.101169]
[23] Peng J, Xiao Y, Wan X, Chen Q, Wang H, Li J, et al. Enhancement of immune response and anti-infection of mice by porcine antimicrobial peptides and interleukin-4/6 fusion gene encapsulated in chitosan nanoparticles. Vaccines (Basel). 2020;8(3):552. [DOI: 10.3390/vaccines8030552] [PMID]
[24] Mahaki H, Saeed Modaghegh MH, Nasr Isfahani Z, Amir Daddost R, Molaei P, Ahmadyousefi Y, et al. The role of peptide-based tumor vaccines on cytokines of adaptive immunity: a review. Int J Pept Res Ther. 2021;27(4):2527-42. [DOI: 10.1007/s10989-021-10270-4]
[25] Raskova M, Lacina L, Kejik Z, Venhauerova A, Skalickova M, Kolar M, et al. The role of IL-6 in cancer cell invasiveness and metastasis-overview and therapeutic opportunities. Cells. 2022;11(22):3698. [DOI: 10.3390/cells11223698] [PMID]
[26] Crotty S. T follicular helper cell differentiation, function, and roles in disease. Immunity. 2014;41(4):529-42. [DOI: 10.1016/j.immuni.2014.10.004] [PMID]
[27] Abbas AK, Benoist C, Bluestone JA, Campbell DJ, Ghosh S, Hori S, et al. Regulatory T cells: recommendations to simplify the nomenclature. Nat Immunol. 2013;14(4):307-8. [DOI: 10.1038/ni.2554] [PMID]
[28] Cho HI, Lee YR, Celis E. Interferon gamma limits the effectiveness of melanoma peptide vaccines. Blood. 2011;117(1):135-44. [DOI: 10.1182/blood-2010-08-298117] [PMID]
[29] Hunter CA, Jones SA. IL-6 as a keystone cytokine in health and disease. Nat Immunol. 2015;16(5):448-57. [DOI: 10.1038/ni.3153] [PMID]
[30] Grivennikov SI, Greten FR, Karin M. Immunity, inflammation, and cancer. Cell. 2010;140(6):883-99. [DOI: 10.1016/j.cell.2010.01.025] [PMID]
[31] Carretero-Iglesia L, Couturaud B, Baumgaertner P, Schmidt J, Maby-El Hajjami H, Speiser DE, et al. High peptide dose vaccination promotes the early selection of tumor antigen-specific CD8 T-cells of enhanced functional competence. Front Immunol. 2020;10:3016. [DOI: 10.3389/fimmu.2019.03016] [PMID]
[32] Gong W, Liang Y, Mi J, Jia Z, Xue Y, Wang J, et al. Peptides-based vaccine MP3RT induced protective immunity against Mycobacterium tuberculosis infection in a humanized mouse model. Front Immunol. 2021;12:666290. [DOI: 10.3389/fimmu.2021.666290] [PMID]
[33] Lian F, Yang H, Hong R, Xu H, Yu T, Sun G, et al. Evaluation of the antitumor effect of neoantigen peptide vaccines derived from the translatome of lung cancer. Cancer Immunol Immunother. 2024;73(7):129. [DOI: 10.1007/s00262-024-03670-0] [PMID]
[34] Kumai T, Kobayashi H, Harabuchi Y, Celis E. Peptide vaccines in cancer-old concept revisited. Curr Opin Immunol. 2017;45:1-7. [DOI: 10.1016/j.coi.2016.11.001] [PMID]
[35] Yang L, Wang L, Zhang Y. Immunotherapy for lung cancer: advances and prospects. Am J Clin Exp Immunol. 2016;5(1):1-20. [PMID]
[36] Hemmati S, Saeidikia Z, Seradj H, Mohagheghzadeh A. Immunomodulatory peptides as vaccine adjuvants and antimicrobial agents. Pharmaceuticals (Basel). 2024;17(2):201. [DOI: 10.3390/ph17020201] [PMID]
[37] Eisenbarth SC, Colegio OR, O'Connor W, Sutterwala FS, Flavell RA. Crucial role for the Nalp3 inflammasome in the immunostimulatory properties of aluminium adjuvants. Nature. 2008;453(7198):1122-6. [DOI: 10.1038/nature06939] [PMID]
[38] Kool M, Soullie T, van Nimwegen M, Willart MA, Muskens F, Jung S, et al. Alum adjuvant boosts adaptive immunity by inducing uric acid and activating inflammatory dendritic cells. J Exp Med. 2008;205(4):869-82. [DOI: 10.1084/jem.20071087] [PMID]
[39] HogenEsch H. Mechanism of immunopotentiation and safety of aluminum adjuvants. Front Immunol. 2013;3:406. [DOI: 10.3389/fimmu.2012.00406] [PMID]
[40] Moyer TJ, Zmolek AC, Irvine DJ. Beyond antigens and adjuvants: formulating future vaccines. J Clin Invest. 2016;126(3):799-808. [DOI: 10.1172/JCI81083] [PMID]
[41] Heidary F, Tourani M, Hejazi-Amiri F, Khatami SH, Jamali N, Taheri-Anganeh M. Design of a new multi-epitope peptide vaccine for non-small cell lung cancer via vaccinology methods: an in silico study. Mol Biol Res Commun. 2022;11(1):55-66. [DOI: 10.22099/mbrc.2022.42468.1697] [PMID]
[42] van Horssen R, Ten Hagen TL, Eggermont AM. TNF-alpha in cancer treatment: molecular insights, antitumor effects, and clinical utility. Oncologist. 2006;11(4):397-408. [DOI: 10.1634/theoncologist.11-4-397] [PMID]
[43] Lawrence T. The nuclear factor NF-kappaB pathway in inflammation. Cold Spring Harb Perspect Biol. 2009;1(6):a001651. [DOI: 10.1101/cshperspect.a001651] [PMID]
[44] Tanaka T, Narazaki M, Kishimoto T. IL-6 in inflammation, immunity, and disease. Cold Spring Harb Perspect Biol. 2014;6(10):a016295. [DOI: 10.1101/cshperspect.a016295] [PMID]
[45] Karakasheva TA, Lin EW, Tang Q, Qiao E, Waldron TJ, Soni M, et al. IL-6 mediates cross-talk between tumor cells and activated fibroblasts in the tumor microenvironment. Cancer Res. 2018;78(17):4957-70. [DOI: 10.1158/0008-5472.CAN-17-2268] [PMID]
[46] Ni L, Lu J. Interferon gamma in cancer immunotherapy. Cancer Med. 2018;7(9):4509-16. [DOI: 10.1002/cam4.1700] [PMID]
[47] Castro F, Cardoso AP, Goncalves RM, Serre K, Oliveira MJ. Interferon-gamma at the crossroads of tumor immune surveillance or evasion. Front Immunol. 2018;9:847. [DOI: 10.3389/fimmu.2018.00847] [PMID]
[48] Zhang Y, Li D, Shen Y, Li S, Lu S, Zheng B. Immunization with a novel mRNA vaccine, TGGT1_216200 mRNA-LNP, prolongs survival time in BALB/c mice against acute toxoplasmosis. Front Immunol. 2023;14:1161507. [DOI: 10.3389/fimmu.2023.1161507] [PMID]
[49] Moore KW, de Waal Malefyt R, Coffman RL, O'Garra A. Interleukin-10 and the interleukin-10 receptor. Annu Rev Immunol. 2001;19:683-765. [DOI: 10.1146/annurev.immunol.19.1.683] [PMID]
[50] Dent AL, Hu-Li J, Paul WE, Staudt LM. T helper type 2 inflammatory disease in the absence of interleukin 4 and transcription factor STAT6. Proc Natl Acad Sci U S A. 1998;95(23):13823-8. [DOI: 10.1073/pnas.95.23.13823] [PMID]
[51] Eisenbarth SC. Dendritic cell subsets in T cell programming: location dictates function. Nat Rev Immunol. 2019;19(2):89-103. [DOI: 10.1038/s41577-018-0088-1] [PMID]
[52] Heinrich PC, Behrmann I, Muller-Newen G, Schaper F, Graeve L. Interleukin-6-type cytokine signalling through the gp130/Jak/STAT pathway. Biochem J. 1998;334(Pt 2):297-314. [DOI: 10.1042/bj3340297] [PMID]
[53] Murray PJ. Understanding and exploiting the endogenous interleukin-10/STAT3-mediated anti-inflammatory response. Curr Opin Pharmacol. 2006;6(4):379-86. [DOI: 10.1016/j.coph.2006.01.010] [PMID]
[54] Hu X, Li J, Fu M, Zhao X, Wang W. The JAK/STAT signaling pathway: from bench to clinic. Signal Transduct Target Ther. 2021;6(1):402. [DOI: 10.1038/s41392-021-00791-1] [PMID]
[55] Bergmann-Leitner ES, Chaudhury S, Steers NJ, Sabato M, Delvecchio V, Wallqvist AS, et al. Computational and experimental validation of B and T-cell epitopes of the in vivo immune response to a novel malarial antigen. PLoS One. 2013;8(8):e71610. [DOI: 10.1371/journal.pone.0071610] [PMID]
[56] Khanum S, Carbone V, Gupta SK, Yeung J, Shu D, Wilson T, et al. Mapping immunogenic epitopes of an adhesin-like protein from Methanobrevibacter ruminantium M1 and comparison of empirical data with in silico prediction methods. Sci Rep. 2022;12(1):10394. [DOI: 10.1038/s41598-022-14545-8] [PMID]
[57] Wang T, Chen S, Wang Y, Zhang Y, Song X, Bi Z, et al. From In Silico to In Vitro: A Comprehensive Guide to Validating Bioinformatics Findings. arXiv [Preprint]. 2025 Jan 24:arXiv:2502.03478. [LINK]
- Abstract Viewed: 136 times
- PDF Downloaded: 15 times